Lineage for d3j3az2 (3j3a z:360-497)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062652Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 2062653Protein Elongation factor 2 (eEF-2), domain II [82118] (2 species)
  7. 2062680Species Human (Homo sapiens) [TaxId:9606] [268002] (1 PDB entry)
  8. 2062681Domain d3j3az2: 3j3a z:360-497 [264916]
    Other proteins in same PDB: d3j3aa_, d3j3ab_, d3j3ac_, d3j3ad_, d3j3ae_, d3j3af_, d3j3ag_, d3j3az1, d3j3az3, d3j3az4, d3j3az5

Details for d3j3az2

PDB Entry: 3j3a (more details), 5 Å

PDB Description: Structure of the human 40S ribosomal proteins
PDB Compounds: (z:) Elongation factor 2

SCOPe Domain Sequences for d3j3az2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j3az2 b.43.3.1 (z:360-497) Elongation factor 2 (eEF-2), domain II {Human (Homo sapiens) [TaxId: 9606]}
spvtaqkyrcellyegppddeaamgikscdpkgplmmyiskmvptsdkgrfyafgrvfsg
lvstglkvrimgpnytpgkkedlylkpiqrtilmmgryvepiedvpcgnivglvgvdqfl
vktgtittfehahnmrvm

SCOPe Domain Coordinates for d3j3az2:

Click to download the PDB-style file with coordinates for d3j3az2.
(The format of our PDB-style files is described here.)

Timeline for d3j3az2: