![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
![]() | Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [267999] (2 PDB entries) Because SCOP is not case sensitive, we included upper case chains from 3j38 and 3j39 and lower case chains from 3j3a and 3j3b |
![]() | Domain d3j39j_: 3j39 J: [264891] |
PDB Entry: 3j39 (more details), 6 Å
SCOPe Domain Sequences for d3j39j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3j39j_ i.1.1.1 (J:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} maavtkkikrdpaknpmrdlhirklclnicvgesgdrltraakvleqltgqqpvfskary tvrsfgirrnekiavhctvrgakaeeilerglkvreyelrrenfsstgnfgfgiqehidl gikydpsigiygldfyvvlgrpgynvnhrkrksgtvgfqhrltkedamkwfqqkydgiil nt
Timeline for d3j39j_: