Lineage for d3j39k_ (3j39 K:)

  1. Root: SCOPe 2.07
  2. 2592940Class i: Low resolution protein structures [58117] (25 folds)
  3. 2592941Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2592942Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2592943Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2593724Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species)
  7. 2593876Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [267999] (2 PDB entries)
    Because SCOP is not case sensitive, we included upper case chains from 3j38 and 3j39 and lower case chains from 3j3a and 3j3b
  8. 2593887Domain d3j39k_: 3j39 K: [264892]

Details for d3j39k_

PDB Entry: 3j39 (more details), 6 Å

PDB Description: Structure of the D. melanogaster 60S ribosomal proteins
PDB Compounds: (K:) 60S ribosomal protein L12

SCOPe Domain Sequences for d3j39k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j39k_ i.1.1.1 (K:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dptevklvylrcvggevgatsslapkigplglspkkigddiakatsdwkglkitvcltiq
nrqaaisvvpsaasliikalkepprdrkkqknikhsgnigfedilaiarvmrprsmarel
kgtckevlgtaqsvgctvdgkhphdvidelnegsievp

SCOPe Domain Coordinates for d3j39k_:

Click to download the PDB-style file with coordinates for d3j39k_.
(The format of our PDB-style files is described here.)

Timeline for d3j39k_: