PDB entry 3j39

View 3j39 on RCSB PDB site
Description: Structure of the D. melanogaster 60S ribosomal proteins
Class: ribosome
Keywords: eukarya, eukaryotic, ribosomal, 80S, RNA, protein synthesis, mass spectrometry, RIBOSOME
Deposited on 2013-02-27, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: EM
Resolution: 6 Å
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60S Ribosomal protein L8
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39a_
  • Chain 'B':
    Compound: 60S Ribosomal protein L3
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39b_
  • Chain 'C':
    Compound: 60S Ribosomal protein L4
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39c_
  • Chain 'D':
    Compound: 60S Ribosomal protein L5
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39d_
  • Chain 'E':
    Compound: 60S ribosomal protein L6, isoform A
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39e_
  • Chain 'F':
    Compound: 60S Ribosomal protein L7
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39f_
  • Chain 'G':
    Compound: 60S Ribosomal protein L7a
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39g_
  • Chain 'H':
    Compound: 60S ribosomal protein L9
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39h_
  • Chain 'I':
    Compound: 60S ribosomal protein L10
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39i_
  • Chain 'J':
    Compound: 60S Ribosomal protein L11
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39j_
  • Chain 'K':
    Compound: 60S ribosomal protein L12
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39k_
  • Chain 'L':
    Compound: 60s ribosomal protein l13
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39l_
  • Chain 'M':
    Compound: 60S ribosomal protein L14
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39m_
  • Chain 'N':
    Compound: 60S ribosomal protein L15
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39n_
  • Chain 'O':
    Compound: 60S ribosomal protein L13a
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39o_
  • Chain 'P':
    Compound: 60S Ribosomal protein L17
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39p_
  • Chain 'Q':
    Compound: 60S Ribosomal protein L18
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39q_
  • Chain 'R':
    Compound: 60S Ribosomal protein L19
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39r_
  • Chain 'S':
    Compound: 60s ribosomal protein l18a
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39s_
  • Chain 'T':
    Compound: 60S Ribosomal protein L21
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39t_
  • Chain 'U':
    Compound: 60S ribosomal protein L22
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39u_
  • Chain 'V':
    Compound: 60s ribosomal protein l23
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39v_
  • Chain 'W':
    Compound: 60S Ribosomal protein L24
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39w_
  • Chain 'X':
    Compound: 60S Ribosomal protein L23a
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39x_
  • Chain 'Y':
    Compound: 60S Ribosomal protein L26
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39y_
  • Chain 'Z':
    Compound: 60S ribosomal protein L27
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3j39z_
  • Chain 'a':
    Compound: 60S Ribosomal protein L27a
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: 60S ribosomal protein L29
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: 60s ribosomal protein l30
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: 60S Ribosomal protein L31
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: 60S Ribosomal protein L32
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: 60S ribosomal protein L35A
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: 60S ribosomal protein L34a
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: 60S Ribosomal protein L35
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: 60s ribosomal protein l36
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: 60S ribosomal protein L37-A
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: 60S ribosomal protein L38
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: 60S ribosomal protein L39
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: 60S ribosomal protein L40
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: 60S ribosomal protein L41
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: 60s ribosomal protein l36a
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: 60S Ribosomal protein L37a
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'q':
    Compound: 60S acidic ribosomal protein P0
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 3J39 (0-222)
  • Chain 'r':
    Compound: 60S ribosomal protein L28
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'z':
    Compound: 60S ribosomal protein L10a-2
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VTP4 (0-217)
      • expression tag (71)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3j39A (A:)
    mgrviraqrkgagsvfkahvkkrkgaaklrsldfaersgyirgvvkdiihdpgrgaplav
    vhfrdpyrykirkelfiapegmhtgqfvycgrkatlqignvmplsqmpegtiicnleekt
    gdrgrlartsgnyatviahnqdtkktrvklpsgakkvvpsanramvgivagggridkpil
    kagrayhkykvkrnswpkvrgvamnpvehphgggnhqhigkastvkrgtsagrkvgliaa
    rrtgrirggkgdskdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39A (A:)
    mgrviraqrkgagsvfkahvkkrkgaaklrsldfaersgyirgvvkdiihdpgrgaplav
    vhfrdpyrykirkelfiapegmhtgqfvycgrkatlqignvmplsqmpegtiicnleekt
    gdrgrlartsgnyatviahnqdtkktrvklpsgakkvvpsanramvgivagggridkpil
    kagrayhkykvkrnswpkvrgvamnpvehphgggnhqhigkastvkrgtsagrkvgliaa
    rrtgrirggkgds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3j39B (B:)
    mshrkfsaprhgsmafypkkrsarhrgkvkafpkddaskpvhltcfigykagmthivrea
    drpgskinkkevveavtvletppmivvgavgyietpfglralvnvwaqhlseecrrrfyk
    nwykskkkaftkaskkwtddlgkksiendfrkmlryckvirviahsqirlikqrqkkahv
    meiqlnggsiedkvkwarehlekpiqvsnvfgqdemidcvgvtkgkgfkgvtsrwhtkkl
    prkthkglrkvacigawhpsrvsttvaragqkgyhhrteinkkiyrigagihtkdgkvik
    nnasteydltdksitpmggfphygevnndfvmikgccigskkriitlrksllkhtkrsal
    eqiklkfidtsskmghgrfqtpadklafmgplkkdrlkeeaaattaaaaaatttsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39B (B:)
    mshrkfsaprhgsmafypkkrsarhrgkvkafpkddaskpvhltcfigykagmthivrea
    drpgskinkkevveavtvletppmivvgavgyietpfglralvnvwaqhlseecrrrfyk
    nwykskkkaftkaskkwtddlgkksiendfrkmlryckvirviahsqirlikqrqkkahv
    meiqlnggsiedkvkwarehlekpiqvsnvfgqdemidcvgvtkgkgfkgvtsrwhtkkl
    prkthkglrkvacigawhpsrvsttvaragqkgyhhrteinkkiyrigagihtkdgkvik
    nnasteydltdksitpmggfphygevnndfvmikgccigskkriitlrksllkhtkrsal
    eqiklkfidtsskmghgrfqtpadklafmgplkkdrlkeeaaattaaaaaattt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3j39C (C:)
    mslgnarplvsvyteknepakdkniclpavfkapirpdvvnevhqllrrnnrqayavsel
    aghqtsaeswgtgravariprvrgggthrsgqgafgnmcrggrmfaptktfrrwhrkvnv
    nqrryalvsaiaasgvpalvqskghvidgvsefplvvsdevqkvqktkqaviflrrlkiw
    adiqkvyksqrfragrgtmrdrrriarrgplvvydkdeglrkafrnipgietinvdklnl
    lklapgghvgrfviwtesafarlndlfgtwkkpstlkkgynlpqpkmantdlsrllksee
    irkvlrdprkrvfrsvrrlnpltnvrqliklnpyaevlkrraalaaekrtvakvlakakk
    qnvelakshfanvatkaaanrakllaarkkkvaakkpaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39C (C:)
    slgnarplvsvyteknepakdkniclpavfkapirpdvvnevhqllrrnnrqayavsela
    ghqtsaeswgtgravariprvrgggthrsgqgafgnmcrggrmfaptktfrrwhrkvnvn
    qrryalvsaiaasgvpalvqskghvidgvsefplvvsdevqkvqktkqaviflrrlkiwa
    diqkvyksqrfragrgtmrdrrriarrgplvvydkdeglrkafrnipgietinvdklnll
    klapgghvgrfviwtesafarlndlfgtwkkpstlkkgynlpqpkmantdlsrllkseei
    rkvlrdprkrvfrsvrrlnpltnvrqliklnpyaevlkrraalaaekrtvakvlakakkq
    nvelakshfanvatkaaanrakllaarkkkva
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3j39D (D:)
    mgfvkvvknkqyfkryqvkfrrrregktdyyarkrltfqdknkyntpkyrlivrlsnkdi
    tvqiayariegdrvvcaayshelpkygiqvgltnyaaayctgllvarrvlnklgldslya
    gctevtgeefnvepvddgpgafrcfldvglartttgarvfgamkgavdgglniphsvkrf
    pgysaetksfnadvhrahifgqhvadymrsleeedeesfkrqfsryiklgiraddlediy
    kkahqairndpthkvtakkssavtkkrwnakkltneqrktkiaahkaayvaklqsetea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39D (D:)
    knkqyfkryqvkfrrrregktdyyarkrltfqdknkyntpkyrlivrlsnkditvqiaya
    riegdrvvcaayshelpkygiqvgltnyaaayctgllvarrvlnklgldslyagctevtg
    eefnvepvddgpgafrcfldvglartttgarvfgamkgavdgglniphsvkrfpgysaet
    ksfnadvhrahifgqhvadymrsleeedeesfkrqfsryiklgiraddlediykkahqai
    rndpthkvtakkssavtkkrwnakkltneqrktkiaahkaayvaklqset
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3j39E (E:)
    mapiekakkvaksakkgkkhpvnsylkggilryskaqmykrralyrlkdkkspvvekakv
    pikkskasyptktfvkkrpskanfsehkrntrrnltpgtvlillagrhqgkrvvllkvla
    sglllvtgpfalnscplrrvsqryvigtsskvdlgafkvpehlndayfrrlkakkdkktg
    eadifaakkerfvpneqrkkdqkevdaallkvikahpegkffakylqnmfalhssqyphr
    mrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39E (E:)
    kgkkhpvnsylkggilryskaqmykrralyrlkdkkspvvekakvpikkskasyptktfv
    kkrpskanfsehkrntrrnltpgtvlillagrhqgkrvvllkvlasglllvtgpfalnsc
    plrrvsqryvigtsskvdlgafkvpehlndayfrrlkakkdkktgeadifaakkerfvpn
    eqrkkdqkevdaallkvikahpegkffakylqnmfalhssqyphrmrf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3j39F (F:)
    mpapvvkkpaakklpavpesklkfskkqiskrvaeskrrlkkaavialrkkenlvraeky
    qneyikaeqreiklrrlakkrnqfyvpaeaklafvvrirginkvapkvrkvlqlfrlrqi
    nngvfiklnkatinmlriaepyitwgypnlksvreliykrgfvkhnrqrvpitdnfvier
    klrqahqiqcvedlvheiftvgpnfkyasnflwpfklntptggwrkkanhyvnggdfgnr
    edqinrllrkmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39F (F:)
    fskkqiskrvaeskrrlkkaavialrkkenlvraekyqneyikaeqreiklrrlakkrnq
    fyvpaeaklafvvrirginkvapkvrkvlqlfrlrqinngvfiklnkatinmlriaepyi
    twgypnlksvreliykrgfvkhnrqrvpitdnfvierklrqahqiqcvedlvheiftvgp
    nfkyasnflwpfklntptggwrkkanhyvnggdfgnredqinrllrkmv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3j39G (G:)
    mvvkkprpkkkpvtkkvapaplavkkpvvkkvvnqlfekrpknfgigqnvqpkrdlsrfv
    rwpkyirvqrqkavlqkrlkvpppihqfsqtldkttavklfkllekyrpesplakklrlk
    kiaeakakgkdvepkkkpsyvsagtntvtklieqkkaqlvviahdvdplelvlflpalcr
    kmgvpycivkgkarlgrlvrrktcttlalttvdnndkanfgkvleavktnfnerheeirr
    hwgggilgskslarisklerakarelaqkqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39G (G:)
    kvvnqlfekrpknfgigqnvqpkrdlsrfvrwpkyirvqrqkavlqkrlkvpppihqfsq
    tldkttavklfkllekyrpesplakklrlkkiaeakakgkdvepkkkpsyvsagtntvtk
    lieqkkaqlvviahdvdplelvlflpalcrkmgvpycivkgkarlgrlvrrktcttlalt
    tvdnndkanfgkvleavktnfnerheeirrhwgggilgskslarisklerakarelaqkq
    g
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3j39H (H:)
    mrtinsnqcvkipkdikasvkarvvtitgtrgtlkrsfkhlaldmympdkrtlkvekwfg
    tkkelaavrtvcshienmikgvtfgfqykmravyahfpincvtsenntvieirnflgeky
    irrvemapgvtvvnstaqkdelivegndiesvsgsaaliqqsttvknkdirkfldglyvs
    ekttvvkles
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3j39I (I:)
    mgrrparcyrycknkpypksrfcrgvpdpkirifdlgrkkatvedfplcvhlvsdeyeql
    ssealeagriccnkylvkycgkdqfhirmrlhpfhvirinkmlscagadrlqtgmrgafg
    kpqgtvarvrigqpimsvrssdrykaqviealrrakfkfpgrqkiyvskkwgftkyerer
    yeelrddnrlepdgcnvkyrpehgpiaawekaqrdvya
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39I (I:)
    grrparcyrycknkpypksrfcrgvpdpkirifdlgrkkatvedfplcvhlvsdeyeqls
    sealeagriccnkylvkycgkdqfhirmrlhpfhvirinkmlscagadrlqtgmrgafgk
    pqgtvarvrigqpimsvrssdrykaqviealrrakfkfpgrqkiyvskkwgftkyerery
    eelrddnrlepdgcnvkyrpehgpiaawekaqrdvya
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3j39J (J:)
    maavtkkikrdpaknpmrdlhirklclnicvgesgdrltraakvleqltgqqpvfskary
    tvrsfgirrnekiavhctvrgakaeeilerglkvreyelrrenfsstgnfgfgiqehidl
    gikydpsigiygldfyvvlgrpgynvnhrkrksgtvgfqhrltkedamkwfqqkydgiil
    ntkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39J (J:)
    maavtkkikrdpaknpmrdlhirklclnicvgesgdrltraakvleqltgqqpvfskary
    tvrsfgirrnekiavhctvrgakaeeilerglkvreyelrrenfsstgnfgfgiqehidl
    gikydpsigiygldfyvvlgrpgynvnhrkrksgtvgfqhrltkedamkwfqqkydgiil
    nt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3j39K (K:)
    mppkfdptevklvylrcvggevgatsslapkigplglspkkigddiakatsdwkglkitv
    cltiqnrqaaisvvpsaasliikalkepprdrkkqknikhsgnigfedilaiarvmrprs
    marelkgtckevlgtaqsvgctvdgkhphdvidelnegsievpae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39K (K:)
    dptevklvylrcvggevgatsslapkigplglspkkigddiakatsdwkglkitvcltiq
    nrqaaisvvpsaasliikalkepprdrkkqknikhsgnigfedilaiarvmrprsmarel
    kgtckevlgtaqsvgctvdgkhphdvidelnegsievp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3j39L (L:)
    mgkgnnmipnqhyhkwwqrhvktwfnqparkvrrhanrvkkakavfprpasgalrpvvrc
    ptiryhtklragrgftleelkgagiganfaktigiavdrrrknkslesrqrniqrlkeyr
    sklilfpinekkiragessleecklatqlkgpvlpikneqpavvefrevtkdekkfkafa
    tlrkartdarlvgirakrakeaaesedaakgdpkkakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39L (L:)
    gkgnnmipnqhyhkwwqrhvktwfnqparkvrrhanrvkkakavfprpasgalrpvvrcp
    tiryhtklragrgftleelkgagiganfaktigiavdrrrknkslesrqrniqrlkeyrs
    klilfpinekkiragessleecklatqlkgpvlpikneqpavvefrevtkdekkfkafat
    lrkartdarlvgirakrakeaaesedaakg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3j39M (M:)
    mpferfvqtgriakasagplkgrlvaivdvidqnrvlvdgpltgvprqeyrlnnlhltky
    rikfpytaptrivrkawtesdlkaqwkvspwsvkaqnickrsslndfdrfklryakrqrn
    klltiafntlkkrtkadgtprvlkkdrrerlraekakggkkaaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39M (M:)
    mpferfvqtgriakasagplkgrlvaivdvidqnrvlvdgpltgvprqeyrlnnlhltky
    rikfpytaptrivrkawtesdlkaqwkvspwsvkaqnickrsslndfdrfklryakrqrn
    klltiafntlkkrtkadgtprvlkkdrrerlraekakgg
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3j39N (N:)
    mgayrymqelyrkkqsdvmryllrirvwqyrqltklhrsprptrpdkarrlgyrakqgfv
    iyrirvrrggrkrpvpkgctygkpkshgvnqlkpyrglqsiaeervgrrlgglrvlnsyw
    iaqdasykyfevilidthhsairrdpkinwickhvhkhrelrgltsagkssrgigkgyry
    sqtiggsrraawkrknrehmhrkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39N (N:)
    gayrymqelyrkkqsdvmryllrirvwqyrqltklhrsprptrpdkarrlgyrakqgfvi
    yrirvrrggrkrpvpkgctygkpkshgvnqlkpyrglqsiaeervgrrlgglrvlnsywi
    aqdasykyfevilidthhsairrdpkinwickhvhkhrelrgltsagkssrgigkgyrys
    qtiggsrraawkrknrehmhrkr
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3j39O (O:)
    mtgltnrtvvidgrghllgrlasvvakyllqggkvavvrceelnlsghfyrnkikflayl
    rkrcnvnpargpfhfrapsrifykavrgmiphktkrgqaalarlrvfdgipspydkrrrv
    vvpiamrvltlrsdrkycqvgrlshevgwhyqdvikslerkrkaklrvtlkhnrelkklt
    vkareniakaaepfnkiiksygyev
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3j39P (P:)
    mgrysresdnvaksckargpnlrvhfknthetaqaikrmplrraqrylkavidqkecvpf
    rrfnggvgrcaqakqwkttqgrwpkksaefllqllrnaeanadckgldadrlvvhhiqvn
    raqclrrrtyrahgrinpymsspchveviltekeelvskatddepakkklskkklqrqke
    kmlrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39P (P:)
    grysresdnvaksckargpnlrvhfknthetaqaikrmplrraqrylkavidqkecvpfr
    rfnggvgrcaqakqwkttqgrwpkksaefllqllrnaeanadckgldadrlvvhhiqvnr
    aqclrrrtyrahgrinpymsspchveviltekeelvskatddepakkklskkklqrqkek
    mlrse
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3j39Q (Q:)
    mgidinhkydrkvrrtepksqdvylrllvklyrflqrrtnkkfnriilkrlfmskinrpp
    lslqriarffkaanqpestivvvgtvtddarllvvpkltvcalhvtqtarerilkaggev
    ltfdqlalrsptgkntlllqgrrtartackhfgkapgvphshtrpyvrskgrkferargr
    rsscgykk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39Q (Q:)
    gidinhkydrkvrrtepksqdvylrllvklyrflqrrtnkkfnriilkrlfmskinrppl
    slqriarffkaanqpestivvvgtvtddarllvvpkltvcalhvtqtarerilkaggevl
    tfdqlalrsptgkntlllqgrrtartackhfgkapgvphshtrpyvrskgrkferargrr
    sscgykk
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3j39R (R:)
    msslklqkrlaasvlrcgkkkvwldpneineiantnsrqnirklikdgliikkpvvvhsr
    yrvrkntearrkgrhcgfgkrkgtanarmptkllwmqrqrvlrrllkkyrdskkidrhly
    hdlymkckgnvfknkrvlmeyihkkkaekqrskmladqaearrqkvrearkrreeriatk
    kqelialhakedeiaakaatagh
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3j39S (S:)
    mrakgllkeyevvgrklpsekepqtplykmrifapdnivaksrfwyflrqlkkfkkttge
    ivsikqvyetspvkiknfgiwlrydsrsgthnmyreyrdltvggavtqcyrdmgarhrar
    ahsiqiikvdsipaaktrrvhvkqfhdskikfplvqrvhhkgnrklfsfrkprtyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39S (S:)
    gllkeyevvgrklpsekepqtplykmrifapdnivaksrfwyflrqlkkfkkttgeivsi
    kqvyetspvkiknfgiwlrydsrsgthnmyreyrdltvggavtqcyrdmgarhrarahsi
    qiikvdsipaaktrrvhvkqfhdskikfplvqrvhhkgnrklfsfrkprtyfq
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3j39T (T:)
    mtnskgyrrgtrdmfsrpfrkhgviplstymrvfkigdivdikghgavqkglpykayhgk
    tgrifnvtqhavgvivnkrvrgkilakrvnvriehihhskcredflrrvkenerllkeak
    ekgqwvslkrqpeqpkkahfvkkleepialapipyefia
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39T (T:)
    tnskgyrrgtrdmfsrpfrkhgviplstymrvfkigdivdikghgavqkglpykayhgkt
    grifnvtqhavgvivnkrvrgkilakrvnvriehihhskcredflrrvkenerllkeake
    kgqwvslkrqpeqpkkahfvkkleepialapipyefia
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3j39U (U:)
    maptaktnkgdtktaaakpaekkaapaaaaakgkvekpkaeaakpaaaaaknvkkaseaa
    kdvkaaaaaakpaaakpaaakpaaaskdagkkapaaaapkkdakaaaapapakaapakka
    astpaaappakkaapakaaapaaaapapaaaapavakpapkpkakaapapskvvkknvlr
    gkgqkkkkvslrftidctniaedsimdvadfekyikarlkvngkvnnlgnnvtfersklk
    livssdvhfskaylkyltkkylkknslrdwirvvanekdsyelryfrissnddedddae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39U (U:)
    qkkkkvslrftidctniaedsimdvadfekyikarlkvngkvnnlgnnvtfersklkliv
    ssdvhfskaylkyltkkylkknslrdwirvvanekdsyelryfrissnddedddae
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3j39V (V:)
    mskrgrggtaggkfrislglpvgavmncadntgaknlyviavhgirgrlnrlpaagvgdm
    fvatvkkgkpelrkkvmpavvirqrkpfrrrdgvfiyfednagvivnnkgemkgsaitgp
    vakecadlwpriasnassia
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39V (V:)
    ggtaggkfrislglpvgavmncadntgaknlyviavhgirgrlnrlpaagvgdmfvatvk
    kgkpelrkkvmpavvirqrkpfrrrdgvfiyfednagvivnnkgemkgsaitgpvakeca
    dlwpriasnassia
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3j39W (W:)
    mkiglcafsgykiypghgktmvkidgksftfldkkcersylmkrnprkvtwtvlyrrkhr
    kgieeeaskkrtrrtqkfqraivgaslaeilakrnmkpevrkaqrdqaikvakeqkravk
    aakkaaapapakksapkqkaakvtqkaaprvggkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39W (W:)
    mkiglcafsgykiypghgktmvkidgksftfldkkcersylmkrnprkvtwtvlyrrkhr
    kgieeeaskkrtrrtqkfqraivgaslaeilakrnmkpevrkaqrdqaikvakeqkravk
    aakkaaapap
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3j39X (X:)
    mppkkpteksakpgdkkpeqkktaaapaagkkeaapsaakpaaaapkkaaapaakkaapa
    akkpatagaaakkpaavkttaaakakskdakkkvlagkkpqsvlaklsakaraaakakkg
    vkpvtkpakgtakakavallnakkvqkkiikgafgtrarkirtnvhfrrpttlklprspk
    yprksvptrnrmdayniikypltteaamkkiednntlvflthlranknhvraavrklydi
    kvakvnvlirpdgqkkayvrlardydaldiankigii
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39X (X:)
    arkirtnvhfrrpttlklprspkyprksvptrnrmdayniikypltteaamkkiednntl
    vflthlranknhvraavrklydikvakvnvlirpdgqkkayvrlardydaldiankigii
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3j39Y (Y:)
    mkqnpfvsssrrknrkrhfqapshirrrlmsaplskelrqkynvrsmpirrddevqvirg
    hfkgnqvgkvvqayrkkfvvyvekiqrenangtnvyvgihpskvlivklkldkdrkaile
    rrgkgrlaalgkdkgkyteetaaqpmeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39Y (Y:)
    kqnpfvsssrrknrkrhfqapshirrrlmsaplskelrqkynvrsmpirrddevqvirgh
    fkgnqvgkvvqayrkkfvvyvekiqrenangtnvyvgihpskvlivklkldkdrkailer
    rgkgrlaalgk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3j39Z (Z:)
    mrkimkqgkivivlsgryagrkaiivkthddgtpekpfghalvagidryprkvtkkmgkn
    klkkkskvkpflkslnynhlmptrytahdisfeklspkdlkdpvkrkthrfqtrvkfesv
    ykegknkwffqklrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3j39Z (Z:)
    rkimkqgkivivlsgryagrkaiivkthddgtpekpfghalvagidryprkvtkkmgknk
    lkkkskvkpflkslnynhlmptrytahdisfeklspkdlkdpvkrkthrfqtrvkfesvy
    kegknkwffqklrf
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'g':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.

  • Chain 'n':
    No sequence available.

  • Chain 'o':
    No sequence available.

  • Chain 'p':
    No sequence available.

  • Chain 'q':
    No sequence available.

  • Chain 'r':
    No sequence available.

  • Chain 'z':
    No sequence available.