SCOPe 2.06: Domain d3b12a_: 3b12 A:

Lineage for d3b12a_ (3b12 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Burkholderia sp. [TaxId:36773] [267823] (1 PDB entry)

8. Domain d3b12a_: 3b12 A: [264701]
   automated match to d3qyjb_
   complexed with fah, mg; mutant

Details for d3b12a_

PDB Entry: 3b12, 1.2 Å

PDB Description: Crystal Structure of the Fluoroacetate Dehalogenase D104 mutant from Burkholderia sp. FA1 in complex with fluoroacetate

PDB Compounds: (A:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d3b12a_:

Sequence; same for both SEQRES and ATOM records:

>d3b12a_ c.69.1.0 (A:) automated matches {Burkholderia sp. [TaxId: 36773]}
mfegferrlvdvgdvtincvvggsgpallllhgfpqnlhmwarvapllaneytvvcadlr
gyggsskpvgapdhanysframasdqrelmrtlgferfhlvgharggrtghrmaldhpds
vlslavldiiptyvmfeevdrfvaraywhwyflqqpapypekvigadpdtfyegclfgwg
atgadgfdpeqleeyrkqwrdpaaihgsccdyraggtidfeldhgdlgrqvqcpalvfsg
saglmhslfemqvvwaprlanmrfaslpgghffvdrfpddtarilreflsdars

Timeline for d3b12a_:

• d3b12a_ first appeared in SCOPe 2.05
  
• d3b12a_ appears in SCOPe 2.07
  
• d3b12a_ appears in the current release, SCOPe 2.08