Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (18 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [267817] (1 PDB entry) |
Domain d2z69a1: 2z69 A:1-150 [264628] Other proteins in same PDB: d2z69a2 automated match to d2pqqa_ |
PDB Entry: 2z69 (more details), 2.1 Å
SCOPe Domain Sequences for d2z69a1:
Sequence, based on SEQRES records: (download)
>d2z69a1 b.82.3.0 (A:1-150) automated matches {Pseudomonas aeruginosa [TaxId: 287]} mefqrvhqqllqshhlfeplspvqlqellassdlvnldkgayvfrqgepahafyylisgc vkiyrltpegqekilevtnerntfaeammfmdtpnyvataqavvpsqlfrfsnkaylrql qdntplalallaklstrlhqrideietlsl
>d2z69a1 b.82.3.0 (A:1-150) automated matches {Pseudomonas aeruginosa [TaxId: 287]} mefqrvhqqllqshhlfeplspvqlqellassdlvnldkgayvfrqgepahafyylisgc vkiyrltpilevtnerntfaeammfmdtpnyvataqavvpsqlfrfsnkaylrqlqdntp lalallaklstrlhqrideietlsl
Timeline for d2z69a1: