SCOPe 2.07: Domain d2z69a1: 2z69 A:1-150

Lineage for d2z69a1 (2z69 A:1-150)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (18 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [267817] (1 PDB entry)

8. Domain d2z69a1: 2z69 A:1-150 [264628]
   Other proteins in same PDB: d2z69a2
   automated match to d2pqqa_

Details for d2z69a1

PDB Entry: 2z69, 2.1 Å

PDB Description: Crystal Structure of the sensor domain of the transcriptional regulator DNR from Pseudomonas aeruginosa

PDB Compounds: (A:) DNR protein

SCOPe Domain Sequences for d2z69a1:

Sequence, based on SEQRES records:

>d2z69a1 b.82.3.0 (A:1-150) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mefqrvhqqllqshhlfeplspvqlqellassdlvnldkgayvfrqgepahafyylisgc
vkiyrltpegqekilevtnerntfaeammfmdtpnyvataqavvpsqlfrfsnkaylrql
qdntplalallaklstrlhqrideietlsl

Sequence, based on observed residues (ATOM records):

>d2z69a1 b.82.3.0 (A:1-150) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mefqrvhqqllqshhlfeplspvqlqellassdlvnldkgayvfrqgepahafyylisgc
vkiyrltpilevtnerntfaeammfmdtpnyvataqavvpsqlfrfsnkaylrqlqdntp
lalallaklstrlhqrideietlsl

Timeline for d2z69a1:

• d2z69a1 first appeared in SCOPe 2.05, called d2z69a_
  
• d2z69a1 appears in SCOPe 2.06
  
• d2z69a1 appears in the current release, SCOPe 2.08