SCOPe 2.05: Domain d2xaqb2: 2xaq B:376-440

Lineage for d2xaqb2 (2xaq B:376-440)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)

6. Protein REST corepressor 1, CoREST [140165] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140166] (22 PDB entries)
   Uniprot Q9UKL0 376-440

8. Domain d2xaqb2: 2xaq B:376-440 [264586]
   Other proteins in same PDB: d2xaqa1, d2xaqa2, d2xaqa3, d2xaqb1
   complexed with fad, m84

Details for d2xaqb2

PDB Entry: 2xaq, 3.2 Å

PDB Description: crystal structure of lsd1-corest in complex with a tranylcypromine derivative (mc2584, 13b)

PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d2xaqb2:

Sequence; same for both SEQRES and ATOM records:

>d2xaqb2 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}
iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq
eweae

Timeline for d2xaqb2:

• d2xaqb2 is new in SCOPe 2.05-stable
  
• d2xaqb2 appears in SCOPe 2.06
  
• d2xaqb2 appears in the current release, SCOPe 2.08