SCOPe 2.05: Domain d2qjma2: 2qjm A:112-402

Lineage for d2qjma2 (2qjm A:112-402)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Novosphingobium aromaticivorans [TaxId:48935] [267802] (3 PDB entries)

8. Domain d2qjma2: 2qjm A:112-402 [264469]
   Other proteins in same PDB: d2qjma1, d2qjmb1, d2qjmc1, d2qjmd1
   automated match to d4il2a2
   complexed with cs2, mg; mutant

Details for d2qjma2

PDB Entry: 2qjm, 2.2 Å

PDB Description: crystal structure of the k271e mutant of mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and d-mannonate

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2qjma2:

Sequence, based on SEQRES records:

>d2qjma2 c.1.11.0 (A:112-402) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
rsrdgimvyghangsdiaetveavghyidmgykairaqtgvpgikdaygvgrgklyyepa
daslpsvtgwdtrkalnyvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyq
lfwledctpaenqeafrlvrqhtvtplavgeifntiwdaedliqnqlidyiratvvgagg
lthlrriadlaslyqvrtgchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavf
phdywfekgelfvgetpghgvdideelaakypykpaylpvarledgtmwnw

Sequence, based on observed residues (ATOM records):

>d2qjma2 c.1.11.0 (A:112-402) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
rsrdgimvyghangsdiaetveavghyidmgykairaqtgvpgislpsvtgwdtrkalny
vpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctpaenqeafrl
vrqhtvtplavgeifntiwdaedliqnqlidyiratvvgagglthlrriadlaslyqvrt
gchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekgelfvgetpg
hgvdideelaakypykpaylpvarledgtmwnw

Timeline for d2qjma2:

• d2qjma2 is new in SCOPe 2.05-stable
  
• d2qjma2 appears in SCOPe 2.06
  
• d2qjma2 appears in the current release, SCOPe 2.08