Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (83 species) not a true protein |
Species Novosphingobium aromaticivorans [TaxId:48935] [267801] (3 PDB entries) |
Domain d2qjmb1: 2qjm B:1-111 [264470] Other proteins in same PDB: d2qjma2, d2qjmb2, d2qjmc2, d2qjmd2 automated match to d4il2a1 complexed with cs2, mg; mutant |
PDB Entry: 2qjm (more details), 2.2 Å
SCOPe Domain Sequences for d2qjmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qjmb1 d.54.1.0 (B:1-111) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]} mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllgg
Timeline for d2qjmb1: