Lineage for d2qjma2 (2qjm A:112-402)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837635Species Novosphingobium aromaticivorans [TaxId:48935] [267802] (3 PDB entries)
  8. 2837644Domain d2qjma2: 2qjm A:112-402 [264469]
    Other proteins in same PDB: d2qjma1, d2qjmb1, d2qjmc1, d2qjmd1
    automated match to d4il2a2
    complexed with cs2, mg; mutant

Details for d2qjma2

PDB Entry: 2qjm (more details), 2.2 Å

PDB Description: crystal structure of the k271e mutant of mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and d-mannonate
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2qjma2:

Sequence, based on SEQRES records: (download)

>d2qjma2 c.1.11.0 (A:112-402) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
rsrdgimvyghangsdiaetveavghyidmgykairaqtgvpgikdaygvgrgklyyepa
daslpsvtgwdtrkalnyvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyq
lfwledctpaenqeafrlvrqhtvtplavgeifntiwdaedliqnqlidyiratvvgagg
lthlrriadlaslyqvrtgchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavf
phdywfekgelfvgetpghgvdideelaakypykpaylpvarledgtmwnw

Sequence, based on observed residues (ATOM records): (download)

>d2qjma2 c.1.11.0 (A:112-402) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
rsrdgimvyghangsdiaetveavghyidmgykairaqtgvpgislpsvtgwdtrkalny
vpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctpaenqeafrl
vrqhtvtplavgeifntiwdaedliqnqlidyiratvvgagglthlrriadlaslyqvrt
gchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekgelfvgetpg
hgvdideelaakypykpaylpvarledgtmwnw

SCOPe Domain Coordinates for d2qjma2:

Click to download the PDB-style file with coordinates for d2qjma2.
(The format of our PDB-style files is described here.)

Timeline for d2qjma2: