SCOPe 2.07: Domain d2h4tb1: 2h4t B:441-656

Lineage for d2h4tb1 (2h4t B:441-656)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families)

5. Family c.43.1.0: automated matches [191456] (1 protein)
   not a true family

6. Protein automated matches [190703] (7 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [267774] (8 PDB entries)

8. Domain d2h4tb1: 2h4t B:441-656 [264298]
   Other proteins in same PDB: d2h4ta2, d2h4tb2
   automated match to d1nm8a2
   complexed with d12

Details for d2h4tb1

PDB Entry: 2h4t, 1.9 Å

PDB Description: crystal structure of rat carnitine palmitoyltransferase ii

PDB Compounds: (B:) Carnitine O-palmitoyltransferase II, mitochondrial

SCOPe Domain Sequences for d2h4tb1:

Sequence; same for both SEQRES and ATOM records:

>d2h4tb1 c.43.1.0 (B:441-656) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsidsiqfqrggkeflkkkqlspdavaqlafqmaflrqygqtvatyescstaafkhgrte
tirpasiftkrcseafvrdpskhsvgelqhmmaecskyhgqltkeatmgqgfdrhlyalr
ylatarglnlpelyldpayqqmnhnilststlnspavslggfapvvpdgfgiayavhddw
igcnvssysgrnareflhcvqkcledifdalegkai

Timeline for d2h4tb1:

• d2h4tb1 first appeared in SCOPe 2.05
  
• d2h4tb1 appears in SCOPe 2.06
  
• d2h4tb1 appears in the current release, SCOPe 2.08