Lineage for d2h4ta1 (2h4t A:441-655)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2482501Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2482502Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2482696Family c.43.1.0: automated matches [191456] (1 protein)
    not a true family
  6. 2482697Protein automated matches [190703] (7 species)
    not a true protein
  7. 2482748Species Norway rat (Rattus norvegicus) [TaxId:10116] [267774] (8 PDB entries)
  8. 2482754Domain d2h4ta1: 2h4t A:441-655 [264297]
    Other proteins in same PDB: d2h4ta2, d2h4tb2
    automated match to d1nm8a2
    complexed with d12

Details for d2h4ta1

PDB Entry: 2h4t (more details), 1.9 Å

PDB Description: crystal structure of rat carnitine palmitoyltransferase ii
PDB Compounds: (A:) Carnitine O-palmitoyltransferase II, mitochondrial

SCOPe Domain Sequences for d2h4ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h4ta1 c.43.1.0 (A:441-655) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsidsiqfqrggkeflkkkqlspdavaqlafqmaflrqygqtvatyescstaafkhgrte
tirpasiftkrcseafvrdpskhsvgelqhmmaecskyhgqltkeatmgqgfdrhlyalr
ylatarglnlpelyldpayqqmnhnilststlnspavslggfapvvpdgfgiayavhddw
igcnvssysgrnareflhcvqkcledifdalegka

SCOPe Domain Coordinates for d2h4ta1:

Click to download the PDB-style file with coordinates for d2h4ta1.
(The format of our PDB-style files is described here.)

Timeline for d2h4ta1: