SCOPe 2.07: Domain d2e6qa1: 2e6q A:8-106

Lineage for d2e6qa1 (2e6q A:8-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2e6qa1: 2e6q A:8-106 [264267]
   Other proteins in same PDB: d2e6qa2, d2e6qa3
   automated match to d2edka_

Details for d2e6qa1

PDB Entry: 2e6q

PDB Description: solution structure of the ig-like domain (615-713) from human obscurin-like protein 1

PDB Compounds: (A:) Obscurin-like protein 1

SCOPe Domain Sequences for d2e6qa1:

Sequence; same for both SEQRES and ATOM records:

>d2e6qa1 b.1.1.0 (A:8-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tarlvagledvqvydgedavfsldlstiiqgtwflngeelksnepegqvepgalryrieq
kglqhrlilhavkhqdsgalvgfscpgvqdsaaltiqes

Timeline for d2e6qa1:

• d2e6qa1 first appeared in SCOPe 2.05, called d2e6qa_
  
• d2e6qa1 appears in SCOPe 2.06
  
• d2e6qa1 appears in the current release, SCOPe 2.08