SCOPe 2.05: Domain d2e6qa_: 2e6q A:

Lineage for d2e6qa_ (2e6q A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2e6qa_: 2e6q A: [264267]
   automated match to d2edka_

Details for d2e6qa_

PDB Entry: 2e6q

PDB Description: solution structure of the ig-like domain (615-713) from human obscurin-like protein 1

PDB Compounds: (A:) Obscurin-like protein 1

SCOPe Domain Sequences for d2e6qa_:

Sequence; same for both SEQRES and ATOM records:

>d2e6qa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgtarlvagledvqvydgedavfsldlstiiqgtwflngeelksnepegqvepga
lryrieqkglqhrlilhavkhqdsgalvgfscpgvqdsaaltiqessgpssg

Timeline for d2e6qa_:

• d2e6qa_ is new in SCOPe 2.05-stable
  
• d2e6qa_ is called d2e6qa1 in SCOPe 2.06
  
• d2e6qa_ appears in the current release, SCOPe 2.08, called d2e6qa1