Lineage for d1wmrb2 (1wmr B:185-564)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806195Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1806196Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 1806368Family b.80.1.0: automated matches [191490] (1 protein)
    not a true family
  6. 1806369Protein automated matches [190791] (5 species)
    not a true protein
  7. 1806370Species Aspergillus niger [TaxId:5061] [261058] (4 PDB entries)
  8. 1806376Domain d1wmrb2: 1wmr B:185-564 [264202]
    Other proteins in same PDB: d1wmra1, d1wmrb1
    automated match to d3wwgb2
    complexed with nag, ndg

Details for d1wmrb2

PDB Entry: 1wmr (more details), 2.4 Å

PDB Description: crystal structure of isopullulanase from aspergillus niger atcc 9642
PDB Compounds: (B:) Isopullulanase

SCOPe Domain Sequences for d1wmrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmrb2 b.80.1.0 (B:185-564) automated matches {Aspergillus niger [TaxId: 5061]}
ensstkpqpgspnsiapapgrvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfa
pgayvkgaveflstasevkasghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlg
nssqtfvlngvtvsappfnsmdwsgnsldlitcrvddykqvgafygqtdglemypgtilq
dvfyhtdddglkmyysnvtarnivmwkesvapvvefgwtprntenvlfdnvdvihqayan
agnnpgifgavnnylyapdglssnhstgnsnmtvrnitwsnfraegsssalfrinpiqnl
dnisiknvsiesfeplsintteswmpvwydlnngkqitvtdfsiegftvgnttitasnaa
svgridgvdpayagsvhyid

SCOPe Domain Coordinates for d1wmrb2:

Click to download the PDB-style file with coordinates for d1wmrb2.
(The format of our PDB-style files is described here.)

Timeline for d1wmrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wmrb1