SCOPe 2.05: Domain d1wmrb1: 1wmr B:16-184

Lineage for d1wmrb1 (1wmr B:16-184)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.133: Dextranase, N-terminal domain [101595] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.133.1: Dextranase, N-terminal domain [101596] (2 families)

5. Family b.133.1.0: automated matches [261054] (1 protein)
   not a true family

6. Protein automated matches [261055] (1 species)
   not a true protein

7. Species Aspergillus niger [TaxId:5061] [261056] (4 PDB entries)

8. Domain d1wmrb1: 1wmr B:16-184 [264201]
   Other proteins in same PDB: d1wmra2, d1wmrb2
   automated match to d3wwgb1
   complexed with nag, ndg

Details for d1wmrb1

PDB Entry: 1wmr, 2.4 Å

PDB Description: crystal structure of isopullulanase from aspergillus niger atcc 9642

PDB Compounds: (B:) Isopullulanase

SCOPe Domain Sequences for d1wmrb1:

Sequence; same for both SEQRES and ATOM records:

>d1wmrb1 b.133.1.0 (B:16-184) automated matches {Aspergillus niger [TaxId: 5061]}
refmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvy
laipgngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvr
ydnqsvyitvpysptgyrfsvefdddlislapsgarqpenallifaspf

Timeline for d1wmrb1:

• d1wmrb1 is new in SCOPe 2.05-stable
  
• d1wmrb1 appears in SCOPe 2.06
  
• d1wmrb1 appears in the current release, SCOPe 2.08