Lineage for d1wmrb1 (1wmr B:20-184)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2412149Fold b.133: Dextranase, N-terminal domain [101595] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2412150Superfamily b.133.1: Dextranase, N-terminal domain [101596] (2 families) (S)
  5. 2412156Family b.133.1.0: automated matches [261054] (1 protein)
    not a true family
  6. 2412157Protein automated matches [261055] (1 species)
    not a true protein
  7. 2412158Species Aspergillus niger [TaxId:5061] [261056] (4 PDB entries)
  8. 2412164Domain d1wmrb1: 1wmr B:20-184 [264201]
    Other proteins in same PDB: d1wmra2, d1wmra3, d1wmrb2, d1wmrb3
    automated match to d3wwgb1
    complexed with nag, ndg

Details for d1wmrb1

PDB Entry: 1wmr (more details), 2.4 Å

PDB Description: crystal structure of isopullulanase from aspergillus niger atcc 9642
PDB Compounds: (B:) Isopullulanase

SCOPe Domain Sequences for d1wmrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmrb1 b.133.1.0 (B:20-184) automated matches {Aspergillus niger [TaxId: 5061]}
avtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvylaip
gngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvrydnq
svyitvpysptgyrfsvefdddlislapsgarqpenallifaspf

SCOPe Domain Coordinates for d1wmrb1:

Click to download the PDB-style file with coordinates for d1wmrb1.
(The format of our PDB-style files is described here.)

Timeline for d1wmrb1: