Lineage for d4w9hj_ (4w9h J:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2538361Protein Elongin B [54246] (2 species)
  7. 2538362Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries)
  8. 2538380Domain d4w9hj_: 4w9h J: [264066]
    Other proteins in same PDB: d4w9hb_, d4w9hc_, d4w9he_, d4w9hf_, d4w9hh_, d4w9hi_, d4w9hk1, d4w9hk2, d4w9hl_
    automated match to d1lqba_
    complexed with 3jf

Details for d4w9hj_

PDB Entry: 4w9h (more details), 2.1 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-((S)-2-acetamido-3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 7)
PDB Compounds: (J:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4w9hj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w9hj_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d4w9hj_:

Click to download the PDB-style file with coordinates for d4w9hj_.
(The format of our PDB-style files is described here.)

Timeline for d4w9hj_: