Lineage for d4w9hk1 (4w9h K:17-112)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552337Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2552338Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2552339Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2552434Protein Elongin C [54699] (3 species)
  7. 2552437Species Human (Homo sapiens) [TaxId:9606] [54700] (54 PDB entries)
  8. 2552457Domain d4w9hk1: 4w9h K:17-112 [264067]
    Other proteins in same PDB: d4w9ha_, d4w9hc_, d4w9hd_, d4w9hf_, d4w9hg_, d4w9hi_, d4w9hj_, d4w9hk2, d4w9hl_
    automated match to d4b9kb_
    complexed with 3jf

Details for d4w9hk1

PDB Entry: 4w9h (more details), 2.1 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-((S)-2-acetamido-3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 7)
PDB Compounds: (K:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d4w9hk1:

Sequence, based on SEQRES records: (download)

>d4w9hk1 d.42.1.1 (K:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d4w9hk1 d.42.1.1 (K:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvrytn
ssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d4w9hk1:

Click to download the PDB-style file with coordinates for d4w9hk1.
(The format of our PDB-style files is described here.)

Timeline for d4w9hk1: