SCOPe 2.07: Domain d2snva_: 2snv A:

Lineage for d2snva_ (2snv A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein Viral capsid protein [50597] (3 species)

7. Species Sindbis virus [TaxId:11034] [50598] (11 PDB entries)

8. Domain d2snva_: 2snv A: [26394]

Details for d2snva_

PDB Entry: 2snv, 2.8 Å

PDB Description: the refined structure of sindbis virus core protein in comparison with other chymotrypsin-like serine proteinase structures

PDB Compounds: (A:) sindbis virus coat protein

SCOPe Domain Sequences for d2snva_:

Sequence; same for both SEQRES and ATOM records:

>d2snva_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]}
rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
adegtrtalsvvtwnskgktikttpegteew

Timeline for d2snva_:

• d2snva_ first appeared (with stable ids) in SCOP 1.55, called d2snv__
  
• d2snva_ appears in SCOPe 2.06
  
• d2snva_ appears in the current release, SCOPe 2.08