Lineage for d2snva_ (2snv A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066379Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2066435Protein Viral capsid protein [50597] (3 species)
  7. 2066442Species Sindbis virus [TaxId:11034] [50598] (11 PDB entries)
  8. 2066457Domain d2snva_: 2snv A: [26394]

Details for d2snva_

PDB Entry: 2snv (more details), 2.8 Å

PDB Description: the refined structure of sindbis virus core protein in comparison with other chymotrypsin-like serine proteinase structures
PDB Compounds: (A:) sindbis virus coat protein

SCOPe Domain Sequences for d2snva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2snva_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]}
rlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmefaqlpvnm
rseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrvvaivlgg
adegtrtalsvvtwnskgktikttpegteew

SCOPe Domain Coordinates for d2snva_:

Click to download the PDB-style file with coordinates for d2snva_.
(The format of our PDB-style files is described here.)

Timeline for d2snva_: