Lineage for d4tumb_ (4tum B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006665Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 3006666Protein automated matches [191267] (8 species)
    not a true protein
  7. 3006736Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [260051] (2 PDB entries)
  8. 3006739Domain d4tumb_: 4tum B: [263925]
    automated match to d4tuma_

Details for d4tumb_

PDB Entry: 4tum (more details), 2.3 Å

PDB Description: Crystal structure of Ankyrin Repeat Domain of AKR2
PDB Compounds: (B:) Ankyrin repeat domain-containing protein 2

SCOPe Domain Sequences for d4tumb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tumb_ d.211.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
esivhqtaslgdveglkaalasggnkdeedsegrtalhfacgygelkcaqvlidagasvn
avdknkntplhyaagygrkecvslllengaavtlqnldektpidvaklnsqlevvkllek
da

SCOPe Domain Coordinates for d4tumb_:

Click to download the PDB-style file with coordinates for d4tumb_.
(The format of our PDB-style files is described here.)

Timeline for d4tumb_: