Lineage for d4tumb_ (4tum B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944478Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1944479Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1944620Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 1944621Protein automated matches [191267] (5 species)
    not a true protein
  7. 1944675Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [260051] (1 PDB entry)
  8. 1944677Domain d4tumb_: 4tum B: [263925]
    automated match to d4tuma_

Details for d4tumb_

PDB Entry: 4tum (more details), 2.3 Å

PDB Description: Crystal structure of Ankyrin Repeat Domain of AKR2
PDB Compounds: (B:) Ankyrin repeat domain-containing protein 2

SCOPe Domain Sequences for d4tumb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tumb_ d.211.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
esivhqtaslgdveglkaalasggnkdeedsegrtalhfacgygelkcaqvlidagasvn
avdknkntplhyaagygrkecvslllengaavtlqnldektpidvaklnsqlevvkllek
da

SCOPe Domain Coordinates for d4tumb_:

Click to download the PDB-style file with coordinates for d4tumb_.
(The format of our PDB-style files is described here.)

Timeline for d4tumb_: