Lineage for d4r18f_ (4r18 F:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2228683Domain d4r18f_: 4r18 F: [263797]
    Other proteins in same PDB: d4r18a_, d4r18b_, d4r18e_, d4r18g_, d4r18i_, d4r18j_, d4r18k_, d4r18l_, d4r18n_, d4r18o_, d4r18s_, d4r18u_, d4r18w_, d4r18x_, d4r18y_, d4r18z_
    automated match to d4g4sg_
    complexed with aba, mg

Details for d4r18f_

PDB Entry: 4r18 (more details), 2.4 Å

PDB Description: Ligand-induced Lys33-Thr1 crosslinking at subunit beta5 of the yeast 20S proteasome
PDB Compounds: (F:) Proteasome subunit alpha type-7

SCOPe Domain Sequences for d4r18f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r18f_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4r18f_:

Click to download the PDB-style file with coordinates for d4r18f_.
(The format of our PDB-style files is described here.)

Timeline for d4r18f_: