Lineage for d4qije_ (4qij E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853061Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2853276Protein automated matches [190669] (6 species)
    not a true protein
  7. 2853314Species Mycobacterium tuberculosis [TaxId:83332] [261127] (2 PDB entries)
  8. 2853331Domain d4qije_: 4qij E: [263709]
    automated match to d1rjnb_
    complexed with 1ha

Details for d4qije_

PDB Entry: 4qij (more details), 2.2 Å

PDB Description: Crystal structure of MenB from Mycobacteria tuberculosis in complex with 1-HNA-CoA
PDB Compounds: (E:) 1,4-Dihydroxy-2-naphthoyl-CoA synthase

SCOPe Domain Sequences for d4qije_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qije_ c.14.1.3 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldha
rmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasgdtadtvdvaragrlhi
levqrlirfmpkvviclvngwaaggghslhvvcdltlasreyarfkqtdadvgsfdggyg
saylarqvgqkfareifflgrtytaeqmhqmgavnavaehaeletvglqwaaeinakspq
aqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdaflqkrppdwspfpryf

SCOPe Domain Coordinates for d4qije_:

Click to download the PDB-style file with coordinates for d4qije_.
(The format of our PDB-style files is described here.)

Timeline for d4qije_: