Lineage for d4q4y1_ (4q4y 1:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431063Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2431354Protein automated matches [190854] (25 species)
    not a true protein
  7. 2431374Species Coxsackievirus a24 [TaxId:12089] [260750] (4 PDB entries)
  8. 2431379Domain d4q4y1_: 4q4y 1: [263631]
    automated match to d2plv1_
    complexed with ca, cl, hez, mg, myr, sia

Details for d4q4y1_

PDB Entry: 4q4y (more details), 1.88 Å

PDB Description: crystal structure of coxsackievirus a24v soaked with disialyllacto-n- tetraose (dslnt)
PDB Compounds: (1:) Coxsackievirus capsid protein VP1

SCOPe Domain Sequences for d4q4y1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q4y1_ b.121.4.1 (1:) automated matches {Coxsackievirus a24 [TaxId: 12089]}
ptaqstpltsgvnsqevpaltavetgasgqavpsdvietrhvvnyktrsestlesffgrs
acvtilevenfnattdadrkkqfttwaitytdtvqlrrklefftysrfdlemtfvitery
yasntgharnqvyqlmyippgaprptawddytwqsssnpsvfytygsapprmsipyvgia
nayshfydgfarvplkdetvdsgdtyyglvtindfgtlavrvvneynparitskirvymk
pkhvrcwcprppravpyrgegvdfkqdsitpltavenintf

SCOPe Domain Coordinates for d4q4y1_:

Click to download the PDB-style file with coordinates for d4q4y1_.
(The format of our PDB-style files is described here.)

Timeline for d4q4y1_: