Lineage for d2plv1_ (2plv 1:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431063Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2431121Protein Poliovirus coat proteins [49666] (3 species)
  7. 2431122Species Poliovirus type 1, strain Mahoney [TaxId:12080] [49667] (13 PDB entries)
  8. 2431155Domain d2plv1_: 2plv 1: [23384]
    complexed with myr, sph

Details for d2plv1_

PDB Entry: 2plv (more details), 2.88 Å

PDB Description: structural factors that control conformational transitions and serotype specificity in type 3 poliovirus
PDB Compounds: (1:) human poliovirus type 1 (subunit vp1)

SCOPe Domain Sequences for d2plv1_:

Sequence, based on SEQRES records: (download)

>d2plv1_ b.121.4.1 (1:) Poliovirus coat proteins {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
gqmlesmidntvsstvgaatsrdalpnteasgpthskeipaltavetgatnplvpsdtvq
trhvvqhrsrsessiesffargacvtimtvdnpasttnkdklfavwkitykdtvqlrrkl
efftysrfdmeltfvvtanftetnnghalnqvyqimyvppgapvpekwddytwqtssnps
ifytygtaparisvpyvgisnayshfydgfskvplkdqsaalgdslygaaslndfgilav
rvvndhnptkvtskirvylkpkhirvwcprppravayygpgvdykdgtltplstkdltty

Sequence, based on observed residues (ATOM records): (download)

>d2plv1_ b.121.4.1 (1:) Poliovirus coat proteins {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
gssstaatsrdalpnteasgpthskeipaltavetgatnplvpsdtvqtrhvvqhrsrse
ssiesffargacvtimtvdnpasttnkdklfavwkitykdtvqlrrklefftysrfdmel
tfvvtanftetnnghalnqvyqimyvppgapvpekwddytwqtssnpsifytygtapari
svpyvgisnayshfydgfskvplkdqsaalgdslygaaslndfgilavrvvndhnptkvt
skirvylkpkhirvwcprppravayygpgvdykdgtltplstkdltty

SCOPe Domain Coordinates for d2plv1_:

Click to download the PDB-style file with coordinates for d2plv1_.
(The format of our PDB-style files is described here.)

Timeline for d2plv1_: