Lineage for d1c5w.1 (1c5w A:,B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1547005Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 1547006Species Human (Homo sapiens) [TaxId:9606] [50587] (68 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 1547043Domain d1c5w.1: 1c5w A:,B: [26359]
    complexed with esi, flc

Details for d1c5w.1

PDB Entry: 1c5w (more details), 1.94 Å

PDB Description: structural basis for selectivity of a small molecule, s1-binding, sub- micromolar inhibitor of urokinase type plasminogen activator
PDB Compounds: (A:) protein (urokinase-type plasminogen activator), (B:) protein (urokinase-type plasminogen activator)

SCOPe Domain Sequences for d1c5w.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1c5w.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lkfqcgqktXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfid
ypkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrc
aqpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqp
hyygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgv
ytrvshflpwirshtkee

SCOPe Domain Coordinates for d1c5w.1:

Click to download the PDB-style file with coordinates for d1c5w.1.
(The format of our PDB-style files is described here.)

Timeline for d1c5w.1: