Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50587] (101 PDB entries) Uniprot P00749 156-178,179-424 |
Domain d1c5w.1: 1c5w A:,B: [26359] complexed with esi, flc |
PDB Entry: 1c5w (more details), 1.94 Å
SCOPe Domain Sequences for d1c5w.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1c5w.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} lkfqcgqktXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfid ypkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrc aqpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqp hyygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgv ytrvshflpwirshtkee
Timeline for d1c5w.1: