![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Coagulation factor Xa, protease domain [50574] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50575] (57 PDB entries) Uniprot P00742 235-467 |
![]() | Domain d1faxa_: 1fax A: [26345] Other proteins in same PDB: d1faxl_ complexed with ca, dx9 |
PDB Entry: 1fax (more details), 3 Å
SCOPe Domain Sequences for d1faxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1faxa_ b.47.1.2 (A:) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnta aeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmktr
Timeline for d1faxa_: