Lineage for d1faxl_ (1fax L:)
- Root: SCOPe 2.07
Class g: Small proteins [56992] (98 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.11: EGF/Laminin [57196] (8 families) 
Family g.3.11.1: EGF-type module [57197] (23 proteins) 
Protein Factor X, N-terminal module [57205] (2 species) Species Human (Homo sapiens) [TaxId:9606] [57206] (85 PDB entries)
Uniprot P00742 127-178
Domain d1faxl_: 1fax L: [44238]
Other proteins in same PDB: d1faxa_
complexed with ca, dx9
Details for d1faxl_
PDB Entry: 1fax (more details), 3 Å
PDB Description: coagulation factor xa inhibitor complex
PDB Compounds: (L:) factor xaSCOPe Domain Sequences for d1faxl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1faxl_ g.3.11.1 (L:) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}
trklcsldngdcdqfcheeqasvvcscargytladngkaciptgpypcgkqtler
SCOPe Domain Coordinates for d1faxl_:
Click to download the PDB-style file with coordinates for d1faxl_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1faxl_:
View in 3D
