SCOPe 2.06: Domain d4ov6g_: 4ov6 G:

Lineage for d4ov6g_ (4ov6 G:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (54 PDB entries)

8. Domain d4ov6g_: 4ov6 G: [263354]
   Other proteins in same PDB: d4ov6b_, d4ov6e_
   automated match to d4ov6f_
   complexed with edo, pg4

Details for d4ov6g_

PDB Entry: 4ov6, 2.69 Å

PDB Description: crystal structure of pcsk9(53-451) with adnectin

PDB Compounds: (G:) adnectin

SCOPe Domain Sequences for d4ov6g_:

Sequence; same for both SEQRES and ATOM records:

>d4ov6g_ b.1.2.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvsdvprdlevvaatptslliswpppshgygyyritygetggnspvqeftvppgkgtati
sglkpgvdytitvyaveypykhsgyyhrpisinyrt

Timeline for d4ov6g_:

• d4ov6g_ first appeared in SCOPe 2.05
  
• d4ov6g_ appears in SCOPe 2.07
  
• d4ov6g_ appears in the current release, SCOPe 2.08