Lineage for d4ov6f_ (4ov6 F:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2035676Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2036221Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2036222Protein automated matches [190976] (4 species)
    not a true protein
  7. 2036246Species Human (Homo sapiens) [TaxId:9606] [188649] (54 PDB entries)
  8. 2036292Domain d4ov6f_: 4ov6 F: [258048]
    Other proteins in same PDB: d4ov6b_, d4ov6e_
    automated match to d2ck2a_
    complexed with edo, pg4

Details for d4ov6f_

PDB Entry: 4ov6 (more details), 2.69 Å

PDB Description: crystal structure of pcsk9(53-451) with adnectin
PDB Compounds: (F:) adnectin

SCOPe Domain Sequences for d4ov6f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ov6f_ b.1.2.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvsdvprdlevvaatptslliswpppshgygyyritygetggnspvqeftvppgkgtati
sglkpgvdytitvyaveypykhsgyyhrpisinyrteid

SCOPe Domain Coordinates for d4ov6f_:

Click to download the PDB-style file with coordinates for d4ov6f_.
(The format of our PDB-style files is described here.)

Timeline for d4ov6f_: