Class b: All beta proteins [48724] (180 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (14 species) not a true protein |
Species Listeria monocytogenes [TaxId:1639] [259405] (3 PDB entries) |
Domain d4nl3l_: 4nl3 L: [263162] automated match to d4nl3k_ protein/RNA complex |
PDB Entry: 4nl3 (more details), 3.1 Å
SCOPe Domain Sequences for d4nl3l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nl3l_ b.38.1.0 (L:) automated matches {Listeria monocytogenes [TaxId: 1639]} mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha istfspqknvalnp
Timeline for d4nl3l_: