Lineage for d4nl3l_ (4nl3 L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787612Species Listeria monocytogenes [TaxId:1639] [259405] (3 PDB entries)
  8. 2787636Domain d4nl3l_: 4nl3 L: [263162]
    automated match to d4nl3k_
    protein/RNA complex

Details for d4nl3l_

PDB Entry: 4nl3 (more details), 3.1 Å

PDB Description: crystal structure of listeria monocytogenes hfq in complex with u6 rna
PDB Compounds: (L:) Protein hfq

SCOPe Domain Sequences for d4nl3l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nl3l_ b.38.1.0 (L:) automated matches {Listeria monocytogenes [TaxId: 1639]}
mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
istfspqknvalnp

SCOPe Domain Coordinates for d4nl3l_:

Click to download the PDB-style file with coordinates for d4nl3l_.
(The format of our PDB-style files is described here.)

Timeline for d4nl3l_: