SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4nl3f_ (4nl3 F:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049048Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2049049Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2049631Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2049632Protein automated matches [190914] (10 species)
    not a true protein
  7. 2049733Species Listeria monocytogenes [TaxId:1639] [259405] (3 PDB entries)
  8. 2049751Domain d4nl3f_: 4nl3 F: [263157]
    automated match to d4nl3k_
    protein/RNA complex

Details for d4nl3f_

PDB Entry: 4nl3 (more details), 3.1 Å

PDB Description: Crystal Structure of Listeria monocytogenes Hfq in complex with U6 RNA
PDB Compounds: (F:) Protein hfq

SCOPe Domain Sequences for d4nl3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nl3f_ b.38.1.0 (F:) automated matches {Listeria monocytogenes [TaxId: 1639]}
mkqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkha
istfspqknvalnpd

SCOPe Domain Coordinates for d4nl3f_:

Click to download the PDB-style file with coordinates for d4nl3f_.
(The format of our PDB-style files is described here.)

Timeline for d4nl3f_: