Lineage for d4lrqc_ (4lrq C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2482762Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2482763Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2482836Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 2482837Protein automated matches [190574] (20 species)
    not a true protein
  7. 2482906Species Vibrio cholerae [TaxId:345073] [257854] (2 PDB entries)
  8. 2482909Domain d4lrqc_: 4lrq C: [262978]
    automated match to d2gi4a_
    complexed with mpo, so4

Details for d4lrqc_

PDB Entry: 4lrq (more details), 1.45 Å

PDB Description: crystal structure of a low molecular weight phosphotyrosine phosphatase from vibrio choleraeo395
PDB Compounds: (C:) Phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d4lrqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lrqc_ c.44.1.0 (C:) automated matches {Vibrio cholerae [TaxId: 345073]}
mqkvlvvcmgnicrsptaeavlrakaaqlkvdvevdsagtigyhqgnppdarskaagekr
gysfsgikarkirdedfvkfdwilaadqenlaelkarcpqshqhklslmlshsdseyqei
pdpyyggergfelvldlvedaaeqfllkl

SCOPe Domain Coordinates for d4lrqc_:

Click to download the PDB-style file with coordinates for d4lrqc_.
(The format of our PDB-style files is described here.)

Timeline for d4lrqc_: