Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) share the common active site structure with the family II |
Family c.44.1.0: automated matches [191415] (1 protein) not a true family |
Protein automated matches [190574] (20 species) not a true protein |
Species Vibrio cholerae [TaxId:345073] [257854] (2 PDB entries) |
Domain d4lrqc_: 4lrq C: [262978] automated match to d2gi4a_ complexed with mpo, so4 |
PDB Entry: 4lrq (more details), 1.45 Å
SCOPe Domain Sequences for d4lrqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lrqc_ c.44.1.0 (C:) automated matches {Vibrio cholerae [TaxId: 345073]} mqkvlvvcmgnicrsptaeavlrakaaqlkvdvevdsagtigyhqgnppdarskaagekr gysfsgikarkirdedfvkfdwilaadqenlaelkarcpqshqhklslmlshsdseyqei pdpyyggergfelvldlvedaaeqfllkl
Timeline for d4lrqc_: