SCOPe 2.06: Domain d4lrqc_: 4lrq C:

Lineage for d4lrqc_ (4lrq C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (17 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:345073] [257854] (1 PDB entry)

8. Domain d4lrqc_: 4lrq C: [262978]
   automated match to d2gi4a_
   complexed with mpo, so4

Details for d4lrqc_

PDB Entry: 4lrq, 1.45 Å

PDB Description: crystal structure of a low molecular weight phosphotyrosine phosphatase from vibrio choleraeo395

PDB Compounds: (C:) Phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d4lrqc_:

Sequence; same for both SEQRES and ATOM records:

>d4lrqc_ c.44.1.0 (C:) automated matches {Vibrio cholerae [TaxId: 345073]}
mqkvlvvcmgnicrsptaeavlrakaaqlkvdvevdsagtigyhqgnppdarskaagekr
gysfsgikarkirdedfvkfdwilaadqenlaelkarcpqshqhklslmlshsdseyqei
pdpyyggergfelvldlvedaaeqfllkl

Timeline for d4lrqc_:

• d4lrqc_ first appeared in SCOPe 2.05
  
• d4lrqc_ appears in SCOPe 2.07
  
• d4lrqc_ appears in the current release, SCOPe 2.08