Lineage for d4liyc_ (4liy C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778904Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 1778905Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 1778906Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 1778907Protein Adenovirus fiber protein "knob" domain [49837] (12 species)
  7. 1778917Species Human adenovirus 3 [TaxId:45659] [267964] (1 PDB entry)
  8. 1778919Domain d4liyc_: 4liy C: [262950]
    automated match to d3cnca_
    complexed with so4; mutant

Details for d4liyc_

PDB Entry: 4liy (more details), 2.1 Å

PDB Description: Structure of the adenovirus 3 knob domain K217E and F224S mutant
PDB Compounds: (C:) fiber protein

SCOPe Domain Sequences for d4liyc_:

Sequence, based on SEQRES records: (download)

>d4liyc_ b.21.1.1 (C:) Adenovirus fiber protein "knob" domain {Human adenovirus 3 [TaxId: 45659]}
knntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknkn
vsinvelyfdatghilpdssslktdleleykqtadssargfmpsttaypfvlpnagthne
nyifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlits
pftfsyiredd

Sequence, based on observed residues (ATOM records): (download)

>d4liyc_ b.21.1.1 (C:) Adenovirus fiber protein "knob" domain {Human adenovirus 3 [TaxId: 45659]}
knntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknkn
vsinvelyfdatghilpdssslktdleleyssargfmpsttaypfvlpnagthnenyifg
qcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlitspftfs
yiredd

SCOPe Domain Coordinates for d4liyc_:

Click to download the PDB-style file with coordinates for d4liyc_.
(The format of our PDB-style files is described here.)

Timeline for d4liyc_: