PDB entry 4liy

View 4liy on RCSB PDB site
Description: Structure of the adenovirus 3 knob domain K217E and F224S mutant
Class: viral protein
Keywords: adenovirus fibre protein knob domain, viral attachment to host cell, receptor interaction, desmoglein 2, VIRAL PROTEIN
Deposited on 2013-07-04, released 2014-05-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.177
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fiber protein
    Species: Human adenovirus 3 [TaxId:45659]
    Gene: L5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04501 (Start-256)
      • engineered mutation (154)
      • engineered mutation (161)
    Domains in SCOPe 2.05: d4liya_
  • Chain 'B':
    Compound: fiber protein
    Species: Human adenovirus 3 [TaxId:45659]
    Gene: L5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04501 (Start-256)
      • engineered mutation (154)
    Domains in SCOPe 2.05: d4liyb_
  • Chain 'C':
    Compound: fiber protein
    Species: Human adenovirus 3 [TaxId:45659]
    Gene: L5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04501 (Start-256)
      • engineered mutation (154)
      • engineered mutation (161)
    Domains in SCOPe 2.05: d4liyc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4liyA (A:)
    mrgshhhhhhgskvsalkekvsalkekvsalkekvsalkekvsalkegsgggsgggsggg
    snsialknntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvnt
    lfknknvsinvelyfdatghilpdssslktdleleykqtadssargfmpsttaypfvlpn
    agthnenyifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettq
    atlitspftfsyiredd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4liyA (A:)
    nntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknknv
    sinvelyfdatghilpdssslktdleleykssargfmpsttaypfvlpnagthnenyifg
    qcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlitspftfs
    yiredd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4liyB (B:)
    mrgshhhhhhgskvsalkekvsalkekvsalkekvsalkekvsalkegsgggsgggsggg
    snsialknntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvnt
    lfknknvsinvelyfdatghilpdssslktdleleykqtadssargfmpsttaypfvlpn
    agthnenyifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettq
    atlitspftfsyiredd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4liyB (B:)
    nntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknknv
    sinvelyfdatghilpdssslktdleleysargfmpsttaypfvlpthnenyifgqcyyk
    asdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlitspftfsyired
    d
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4liyC (C:)
    mrgshhhhhhgskvsalkekvsalkekvsalkekvsalkekvsalkegsgggsgggsggg
    snsialknntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvnt
    lfknknvsinvelyfdatghilpdssslktdleleykqtadssargfmpsttaypfvlpn
    agthnenyifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettq
    atlitspftfsyiredd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4liyC (C:)
    knntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknkn
    vsinvelyfdatghilpdssslktdleleyssargfmpsttaypfvlpnagthnenyifg
    qcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlitspftfs
    yiredd