![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
![]() | Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
![]() | Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
![]() | Protein Adenovirus fiber protein "knob" domain [49837] (12 species) |
![]() | Species Human adenovirus 3 [TaxId:45659] [267964] (1 PDB entry) |
![]() | Domain d4liyb_: 4liy B: [262949] automated match to d3cnca_ complexed with so4; mutant |
PDB Entry: 4liy (more details), 2.1 Å
SCOPe Domain Sequences for d4liyb_:
Sequence, based on SEQRES records: (download)
>d4liyb_ b.21.1.1 (B:) Adenovirus fiber protein "knob" domain {Human adenovirus 3 [TaxId: 45659]} nntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknknv sinvelyfdatghilpdssslktdleleykqtadssargfmpsttaypfvlpnagthnen yifgqcyykasdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlitsp ftfsyiredd
>d4liyb_ b.21.1.1 (B:) Adenovirus fiber protein "knob" domain {Human adenovirus 3 [TaxId: 45659]} nntlwtgpkpeanciieygkqnpdskltlilvknggivngyvtlmgasdyvntlfknknv sinvelyfdatghilpdssslktdleleysargfmpsttaypfvlpthnenyifgqcyyk asdgalfplevtvmlnkrlpdsrtsyvmtflwslnaglapettqatlitspftfsyired d
Timeline for d4liyb_: