Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
Protein automated matches [190197] (24 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [256984] (5 PDB entries) |
Domain d4l7qc_: 4l7q C: [262906] automated match to d4l7qa_ complexed with gol |
PDB Entry: 4l7q (more details), 2.1 Å
SCOPe Domain Sequences for d4l7qc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l7qc_ c.23.16.0 (C:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtclgfelltlltsgelll shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl kkfyrvlstntdgynkfvstmeaydfpiyatqwhpeknafewtrpyiphtpsaikttfym anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn
Timeline for d4l7qc_: