Lineage for d4l7qa_ (4l7q A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467009Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2467511Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2467512Protein automated matches [190197] (24 species)
    not a true protein
  7. 2467777Species Zebrafish (Danio rerio) [TaxId:7955] [256984] (5 PDB entries)
  8. 2467786Domain d4l7qa_: 4l7q A: [256985]
    automated match to d1l9xa_
    complexed with gol

Details for d4l7qa_

PDB Entry: 4l7q (more details), 2.1 Å

PDB Description: Crystal structure of gamma glutamyl hydrolase (wild-type) from zebrafish
PDB Compounds: (A:) gamma-glutamyl hydrolase

SCOPe Domain Sequences for d4l7qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l7qa_ c.23.16.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
ktnerpiigvlaqdvfdpkpdrnsyiaasyvkflesagarvvpvminksedeysrlfksi
ngvlfpgggvslessgyskaagifyrlaleansngdyfpvwgtclgfelltlltsgelll
shtntsgialpldftedvkgsrlfkefpeelmkslatepltenshqwsittenftankkl
kkfyrvlstntdgynkfvstmeaydfpiyatqwhpeknafewtrpyiphtpsaikttfym
anffvnearknlhsfasteeeekaliynykpeytgiqsafeqtyffn

SCOPe Domain Coordinates for d4l7qa_:

Click to download the PDB-style file with coordinates for d4l7qa_.
(The format of our PDB-style files is described here.)

Timeline for d4l7qa_: