SCOPe 2.08: Domain d1cgha_: 1cgh A:

Lineage for d1cgha_ (1cgh A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Cathepsin G [50548] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50549] (4 PDB entries)

8. Domain d1cgha_: 1cgh A: [26290]
   complexed with 1zg

Details for d1cgha_

PDB Entry: 1cgh, 1.8 Å

PDB Description: Human cathepsin G

PDB Compounds: (A:) cathepsin G

SCOPe Domain Sequences for d1cgha_:

Sequence; same for both SEQRES and ATOM records:

>d1cgha_ b.47.1.2 (A:) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]}
iiggresrphsrpymaylqiqspagqsrcggflvredfvltaahcwgsninvtlgahniq
rrentqqhitarrairhpqynqrtiqndimllqlsrrvrrnrnvnpvalpraqeglrpgt
lctvagwgrvsmrrgtdtlrevqlrvqrdrqclrifgsydprrqicvgdrrerkaafkgd
sggpllcnnvahgivsygkssgvppevftrvssflpwirttmrs

Timeline for d1cgha_:

• d1cgha_ first appeared (with stable ids) in SCOP 1.55
  
• d1cgha_ appears in SCOPe 2.07