Lineage for d1cgha_ (1cgh A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 14985Protein Cathepsin G [50548] (1 species)
  7. 14986Species Human (Homo sapiens) [TaxId:9606] [50549] (2 PDB entries)
  8. 14987Domain d1cgha_: 1cgh A: [26290]

Details for d1cgha_

PDB Entry: 1cgh (more details), 1.8 Å

PDB Description: Human cathepsin G

SCOP Domain Sequences for d1cgha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgha_ b.47.1.2 (A:) Cathepsin G {Human (Homo sapiens)}
iiggresrphsrpymaylqiqspagqsrcggflvredfvltaahcwgsninvtlgahniq
rrentqqhitarrairhpqynqrtiqndimllqlsrrvrrnrnvnpvalpraqeglrpgt
lctvagwgrvsmrrgtdtlrevqlrvqrdrqclrifgsydprrqicvgdrrerkaafkgd
sggpllcnnvahgivsygkssgvppevftrvssflpwirttmrs

SCOP Domain Coordinates for d1cgha_:

Click to download the PDB-style file with coordinates for d1cgha_.
(The format of our PDB-style files is described here.)

Timeline for d1cgha_: