Lineage for d4im9c1 (4im9 C:12-144)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2019999Fold a.236: DNA primase DnaG, C-terminal domain [117022] (1 superfamily)
    multihelical; segment-swapped dimer
  4. 2020000Superfamily a.236.1: DNA primase DnaG, C-terminal domain [117023] (2 families) (S)
    automatically mapped to Pfam PF08278
  5. 2020007Family a.236.1.0: automated matches [256784] (1 protein)
    not a true family
  6. 2020008Protein automated matches [256785] (1 species)
    not a true protein
  7. 2020009Species Vibrio cholerae [TaxId:345073] [256786] (1 PDB entry)
  8. 2020012Domain d4im9c1: 4im9 C:12-144 [262728]
    Other proteins in same PDB: d4im9b2, d4im9c2
    automated match to d4im9a_
    protein/DNA complex

Details for d4im9c1

PDB Entry: 4im9 (more details), 2.46 Å

PDB Description: Cystal structure of DnaG primase C-terminal domain from Vibrio cholerae
PDB Compounds: (C:) DNA primase

SCOPe Domain Sequences for d4im9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4im9c1 a.236.1.0 (C:12-144) automated matches {Vibrio cholerae [TaxId: 345073]}
tpmrdvialliqnpsyaelvpdlasvrhlmipgldtfsevlekcrqyphittgqllehwr
dsknetllsrlasweiplvednqeelfldsldkilaqcvekqienlqakersvglsteek
relqdlilkglka

SCOPe Domain Coordinates for d4im9c1:

Click to download the PDB-style file with coordinates for d4im9c1.
(The format of our PDB-style files is described here.)

Timeline for d4im9c1: