SCOPe 2.06: Domain d4dh2d_: 4dh2 D:

Lineage for d4dh2d_ (4dh2 D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.139: Type I dockerin domain [63445] (1 superfamily)
   tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand

4. Superfamily a.139.1: Type I dockerin domain [63446] (2 families)

5. Family a.139.1.0: automated matches [191542] (1 protein)
   not a true family

6. Protein automated matches [190928] (7 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:203119] [194257] (4 PDB entries)

8. Domain d4dh2d_: 4dh2 D: [262693]
   Other proteins in same PDB: d4dh2a1, d4dh2a2, d4dh2c1, d4dh2c2
   automated match to d4fl4g_
   complexed with ca, so4

Details for d4dh2d_

PDB Entry: 4dh2, 1.75 Å

PDB Description: Crystal structure of Coh-OlpC(Cthe_0452)-Doc435(Cthe_0435) complex: A novel type I Cohesin-Dockerin complex from Clostridium thermocellum ATTC 27405

PDB Compounds: (D:) Dockerin type 1

SCOPe Domain Sequences for d4dh2d_:

Sequence; same for both SEQRES and ATOM records:

>d4dh2d_ a.139.1.0 (D:) automated matches {Clostridium thermocellum [TaxId: 203119]}
avigdvnadgvvnisdyvlmkryilriiadfpadddmwvgdvngdnvindidcnylkryl
lhmirefpkn

Timeline for d4dh2d_:

• d4dh2d_ first appeared in SCOPe 2.05
  
• d4dh2d_ appears in SCOPe 2.07
  
• d4dh2d_ appears in the current release, SCOPe 2.08