![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.139: Type I dockerin domain [63445] (1 superfamily) tandem repeat of two calcium-binding loop-helix motifs, distinct from the EF-hand |
![]() | Superfamily a.139.1: Type I dockerin domain [63446] (2 families) ![]() |
![]() | Family a.139.1.0: automated matches [191542] (1 protein) not a true family |
![]() | Protein automated matches [190928] (7 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:203119] [194257] (4 PDB entries) |
![]() | Domain d4dh2b_: 4dh2 B: [262692] Other proteins in same PDB: d4dh2a1, d4dh2a2, d4dh2c1, d4dh2c2 automated match to d4fl4g_ complexed with ca, so4 |
PDB Entry: 4dh2 (more details), 1.75 Å
SCOPe Domain Sequences for d4dh2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dh2b_ a.139.1.0 (B:) automated matches {Clostridium thermocellum [TaxId: 203119]} avigdvnadgvvnisdyvlmkryilriiadfpadddmwvgdvngdnvindidcnylkryl lhmirefpknsy
Timeline for d4dh2b_: