Lineage for d4d00e_ (4d00 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776782Species Influenza virus a/jiangxi- donghu/346/2013 (h10n8) [TaxId:11309] [256758] (1 PDB entry)
  8. 2776785Domain d4d00e_: 4d00 E: [262681]
    Other proteins in same PDB: d4d00b_, d4d00d_, d4d00f_
    automated match to d1rd8a_
    complexed with nag, ni

Details for d4d00e_

PDB Entry: 4d00 (more details), 2.5 Å

PDB Description: haemagglutinin of h10n8 influenza virus isolated from humans in complex with human receptor analogue 6'sln
PDB Compounds: (E:) haemagglutinin ha1

SCOPe Domain Sequences for d4d00e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d00e_ b.19.1.0 (E:) automated matches {Influenza virus a/jiangxi- donghu/346/2013 (h10n8) [TaxId: 11309]}
pdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
kyvnrrslmlatgmrnvpe

SCOPe Domain Coordinates for d4d00e_:

Click to download the PDB-style file with coordinates for d4d00e_.
(The format of our PDB-style files is described here.)

Timeline for d4d00e_: