PDB entry 4d00

View 4d00 on RCSB PDB site
Description: Haemagglutinin of H10N8 Influenza Virus Isolated from Humans in Complex with Human Receptor Analogue 6'SLN
Class: viral protein
Keywords: viral protein, h10n8, influenza, sialic acid, glycoprotein, virus receptor, avian flu, sialyllactosamine, lsta
Deposited on 2014-04-23, released 2014-06-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.20978
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haemagglutinin ha1
    Species: INFLUENZA VIRUS A/JIANGXI- DONGHU/346/2013 (H10N8) [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 4D00
    Domains in SCOPe 2.07: d4d00a_
  • Chain 'B':
    Compound: haemagglutinin ha1
    Species: INFLUENZA VIRUS A/JIANGXI- DONGHU/346/2013 (H10N8) [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 4D00 (0-End)
    Domains in SCOPe 2.07: d4d00b_
  • Chain 'C':
    Compound: haemagglutinin ha1
    Species: INFLUENZA VIRUS A/JIANGXI- DONGHU/346/2013 (H10N8) [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 4D00 (0-End)
    Domains in SCOPe 2.07: d4d00c_
  • Chain 'D':
    Compound: haemagglutinin ha1
    Species: INFLUENZA VIRUS A/JIANGXI- DONGHU/346/2013 (H10N8) [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 4D00 (0-End)
    Domains in SCOPe 2.07: d4d00d_
  • Chain 'E':
    Compound: haemagglutinin ha1
    Species: INFLUENZA VIRUS A/JIANGXI- DONGHU/346/2013 (H10N8) [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 4D00
    Domains in SCOPe 2.07: d4d00e_
  • Chain 'F':
    Compound: haemagglutinin ha1
    Species: INFLUENZA VIRUS A/JIANGXI- DONGHU/346/2013 (H10N8) [TaxId:11309]
    Database cross-references and differences (RAF-indexed):
    • PDB 4D00 (0-End)
    Domains in SCOPe 2.07: d4d00f_
  • Heterogens: NAG, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d00A (A:)
    adpdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpi
    gmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgfty
    gssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihh
    psstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnit
    fshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgq
    cpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d00A (A:)
    pdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
    ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
    sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnrrslmlatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4d00B (B:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninpvtlss
    gyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d00B (B:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4d00C (C:)
    adpdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpi
    gmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgfty
    gssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihh
    psstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnit
    fshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgq
    cpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d00C (C:)
    adpdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpi
    gmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgfty
    gssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihh
    psstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnit
    fshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgq
    cpkyvnrrslmlatgmrnvpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4d00D (D:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninpvtlss
    gyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d00D (D:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninpv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4d00E (E:)
    adpdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpi
    gmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgfty
    gssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihh
    psstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnit
    fshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgq
    cpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d00E (E:)
    pdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
    ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
    sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnrrslmlatgmrnvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4d00F (F:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlninpvtlss
    gyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d00F (F:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlni