![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza virus a/jiangxi- donghu/346/2013 (h10n8) [TaxId:11309] [256758] (1 PDB entry) |
![]() | Domain d4d00c_: 4d00 C: [257773] Other proteins in same PDB: d4d00b_, d4d00d_, d4d00f_ automated match to d1rd8a_ complexed with nag, ni |
PDB Entry: 4d00 (more details), 2.5 Å
SCOPe Domain Sequences for d4d00c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d00c_ b.19.1.0 (C:) automated matches {Influenza virus a/jiangxi- donghu/346/2013 (h10n8) [TaxId: 11309]} adpdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpi gmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgfty gssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihh psstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnit fshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgq cpkyvnrrslmlatgmrnvpe
Timeline for d4d00c_: